Detailed Website Analysis

Domains linking to regerveinandskinspecialists.myonlineappointment.com

In this page you will find a list of websites which have posted a link to regerveinandskinspecialists.myonlineappointment.com

  • Total number of sites found: 1

  • Number of sites displayed: 1

Links discovered

Reger Vein and Skin Specialists - Vein Specialist The Woodlands TX - Botox The Woodlands TX

http://portalanalyse.com/domain-info/veinandlaser.org
  • Address renewed on: 30-08-2016
  • Registration date: 12-09-2007
  • Analytics: 6354412-2
  • Day of Expiration: 12-09-2018
  • G+ Profile ID: 113722835818328693894